Last searches

merrychristmashappynewyear.info ffz63d.makeye.cn 8xg57ey.moudia.com green-mechanic.com ie9vzi.sellerser.com at0.nunhuan.com journeystravelgear.com 35d6.chuaqiong.com pygmypony.net footballnews.ge brownbookit.com bbsetk8.niuchua.com i6ytgcak.nunzhuai.com fahbvd.thedywa.cn jamieschultzdesigns.com jieshiw.co.chinaweiyu.com bkk-faber-castell.de codeasy.in 3wa2j.lowiu.com openritz.com

Best scoring websites at Alexa.

https:/www.bestsexphoto.info/pov-/ eutr.fujiuchi-chiro.com koreanetwork.com/user/logout https://biggbosstvshow.com/ 2461904.862sc.com 2940211.862sc.com 3900299.862sc.com https://fitbitehealth.com/apex-booty/ https:/www.topsexpics.eu/music-/ www.gtamonitor.ru smithlegalcenter.com reservainn.com/__media__/js/netsoltrademark.php?d=eerx.com/search/mayleena-smith-page-1.php aging-genes2014.com/hots-indonesian.htm 1360195.862sc.com https:/www.bestsexphoto.info/pov-/;POV focuskoeriers.nl berlinzones.wapka.mobi/site_0.html.com/.sitetool.org// othichnhi.com https:/www.topsexpics.eu/music-/;Music 3322252.862sc.com



Information about the website crystalstine.me.

We took the screenshot and data from this website at 2017-08-06 10:55:32.

Link to crystalstine.me


Site title: Hi! I'm Crystal. - Crystal Stine
Site description:
Site keywords:
Your browser:
Your ipadress: N/A
Google pagerank: No data av
Thumbnail:
Dmoz Description:
Dmoz Category:
Alexa Links:
Alexa Rank: 4145985
Alexa Reach: 4357764
Alexa country United States rank 609665
Whois:
Domain Name: CRYSTALSTINE.ME
Registry Domain ID: D108500000007792088-AGRS
Registrar WHOIS Server:
Registrar URL: http://www.godaddy.com
Updated Date: 2017-03-18T14:14:05Z
Creation Date: 2013-03-17T03:00:35Z
Registry Expiry Date: 2018-03-17T03:00:35Z
Registrar Registration Expiration Date:
Registrar: GoDaddy.com, LLC
Registrar IANA ID: 146
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Reseller:
Domain Status: clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited
Domain Status: clientRenewProhibited https://icann.org/epp#clientRenewProhibited
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Domain Status: clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited
Registry Registrant ID: C4622872-AGRS
Registrant Name: Registration Private
Registrant Organization: Domains By Proxy, LLC
Registrant Street: DomainsByProxy.com
Registrant Street: 14455 N. Hayden Road
Registrant City: Scottsdale
Registrant State/Province: Arizona
Registrant Postal Code: 85260
Registrant Country: US
Registrant Phone: +1.4806242599
Registrant Phone Ext:
Registrant Fax: +1.4806242598
Registrant Fax Ext:
Registrant Email: CRYSTALSTINE.ME@domainsbyproxy.com
Registry Admin ID: C4432662-AGRS
Admin Name: Registration Private
Admin Organization: Domains By Proxy, LLC
Admin Street: DomainsByProxy.com
Admin Street: 14455 N. Hayden Road
Admin City: Scottsdale
Admin State/Province: Arizona
Admin Postal Code: 85260
Admin Country: US
Admin Phone: +1.4806242599
Admin Phone Ext:
Admin Fax: +1.4806242598
Admin Fax Ext:
Admin Email: CRYSTALSTINE.ME@domainsbyproxy.com
Registry Tech ID: C4517560-AGRS
Tech Name: Registration Private
Tech Organization: Domains By Proxy, LLC
Tech Street: DomainsByProxy.com
Tech Street: 14455 N. Hayden Road
Tech City: Scottsdale
Tech State/Province: Arizona
Tech Postal Code: 85260
Tech Country: US
Tech Phone: +1.4806242599
Tech Phone Ext:
Tech Fax: +1.4806242598
Tech Fax Ext:
Tech Email: CRYSTALSTINE.ME@domainsbyproxy.com
Name Server: NS1.FISTBUMPMEDIA.COM
Name Server: NS2.FISTBUMPMEDIA.COM
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of WHOIS database: 2017-08-06T08:52:02Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Access to WHOIS information is provided to assist persons in determining the contents of a domain name registration record in the registry database. The data in this record is provided by The Registry Operator for informational purposes only, and accuracy is not guaranteed.  This service is intended only for query-based access. You agree that you will use this data only for lawful purposes and that, under no circumstances will you use this data to: (a) allow, enable, or otherwise support the transmission by e-mail, telephone, or facsimile of mass unsolicited, commercial advertising or solicitations to entities other than the data recipient's own existing customers; or (b) enable high volume, automated, electronic processes that send queries or data to the systems of Registry Operator, a Registrar, or Afilias except as reasonably necessary to register domain names or modify existing registrations. All rights reserved. Registry Operator reserves the right to modify these terms at any time. By submitting this query, you agree to abide by this policy.
URL: crystalstine.me

Headers

Info:
HTTP/1.1 302 Found

Date: Tue, 23 Jan 2018 19:20:28 GMT
Server: Apache
Location: https://crystalstine.me/
Content-Type: text/html; charset=iso-8859-1